HORDB

ID: hor004139
Uniprot ID: P83862
Protein name: QRF-amide
Gene name: QRFP
Organism: Bos taurus (Bovine)
Family: RFamide neuropeptide family
Source: Animal
Expression: Expressed in the hypothalamus.
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005184 neuropeptide hormone activity; GO:0031854 orexigenic neuropeptide QRFP receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007626 locomotory behavior; GO:0045777 positive regulation of blood pressure; GO:0060259 regulation of feeding behavior
GO CC: GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence: QDDGSEATGLLLGEAEKVGGLLGTLAEELNGYSRKKGGFSFRF
Length: 43(89-131)
Propeptide: MRSPYSLPYLLFLPLGACFPVLDTEEPVDAVGGTGREMSWMDPARGRPFPWGSPGWPRAPYPHALLVTAKELRASGKARAGFQLRLGRQDDGSEATGLLLGEAEKVGGLLGTLAEELNGYSRKKGGFSFRFGRR
Signal peptide: MRSPYSLPYLLFLPLGAC
Modification: T43 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates feeding behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004139_AF2.pdb

hor004139_ESM.pdb

Mass:	526834	Formula:	C199H314N54O66
Absent amino acids:	CHIMPW	Common amino acids:	G
pI:	4.48	Basic residues:	5
Polar residues:	16	Hydrophobic residues:	14
Hydrophobicity:	-37.91	Boman Index:	-6433
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	77.21
Instability Index:	1943.02	Extinction Coefficient cystines:	1490
Absorbance 280nm:	35.48